Anti PRR14 pAb (ATL-HPA060265)

Atlas Antibodies

SKU: ATL-HPA060265-25

• 

Protein Description: proline rich 14
Gene Name: PRR14
Alternative Gene Name: MGC3121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030822: 49%, ENSRNOG00000018518: 49%
Entrez Gene ID: 78994
Uniprot ID: Q9BWN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHRTSSTLRRRSRTTPGPEEGPSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALPADPLESPPTAPDP
• Gene Sequence: IHRTSSTLRRRSRTTPGPEEGPSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALPADPLESPPTAPDP
• Gene ID - Mouse: ENSMUSG00000030822
• Gene ID - Rat: ENSRNOG00000018518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRR14 pAb (ATL-HPA060265) – 1 Found

Li, Fangfang; Zhang, Chundong; Fu, Lijuan. PRR14 overexpression promotes cell growth, epithelial to mesenchymal transition and metastasis of colon cancer via the AKT pathway. Plos One. 14(10):e0218839.