Anti PRPF38A pAb (ATL-HPA053099)

Atlas Antibodies

SKU: ATL-HPA053099-100

• 
• 
• 

Protein Description: pre-mRNA processing factor 38A
Gene Name: PRPF38A
Alternative Gene Name: FLJ14936, Prp38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063800: 97%, ENSRNOG00000009451: 100%
Entrez Gene ID: 84950
Uniprot ID: Q8NAV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVL
• Gene Sequence: NEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVL
• Gene ID - Mouse: ENSMUSG00000063800
• Gene ID - Rat: ENSRNOG00000009451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.