Anti PROZ pAb (ATL-HPA052006 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052006-25

• 
• 

Protein Description: protein Z, vitamin K-dependent plasma glycoprotein
Gene Name: PROZ
Alternative Gene Name: PZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031445: 63%, ENSRNOG00000019700: 62%
Entrez Gene ID: 8858
Uniprot ID: P22891
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYS
• Gene Sequence: TPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYS
• Gene ID - Mouse: ENSMUSG00000031445
• Gene ID - Rat: ENSRNOG00000019700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.