Anti PROKR2 pAb (ATL-HPA047281)

Atlas Antibodies

SKU: ATL-HPA047281-25

• 

Protein Description: prokineticin receptor 2
Gene Name: PROKR2
Alternative Gene Name: dJ680N4.3, GPR73b, GPR73L1, GPRg2, KAL3, PKR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050558: 67%, ENSRNOG00000021266: 69%
Entrez Gene ID: 128674
Uniprot ID: Q8NFJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
• Gene Sequence: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
• Gene ID - Mouse: ENSMUSG00000050558
• Gene ID - Rat: ENSRNOG00000021266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.