Anti PRODH2 pAb (ATL-HPA051287)

Atlas Antibodies

SKU:
ATL-HPA051287-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line HepG2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline dehydrogenase (oxidase) 2
Gene Name: PRODH2
Alternative Gene Name: HSPOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036892: 72%, ENSRNOG00000057578: 65%
Entrez Gene ID: 58510
Uniprot ID: Q9UF12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQ
Gene Sequence GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQ
Gene ID - Mouse ENSMUSG00000036892
Gene ID - Rat ENSRNOG00000057578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRODH2 pAb (ATL-HPA051287)
Datasheet Anti PRODH2 pAb (ATL-HPA051287) Datasheet (External Link)
Vendor Page Anti PRODH2 pAb (ATL-HPA051287) at Atlas Antibodies

Documents & Links for Anti PRODH2 pAb (ATL-HPA051287)
Datasheet Anti PRODH2 pAb (ATL-HPA051287) Datasheet (External Link)
Vendor Page Anti PRODH2 pAb (ATL-HPA051287)