Protein Description: protein arginine methyltransferase 5
Gene Name: PRMT5
Alternative Gene Name: HRMT1L5, SKB1, SKB1Hs
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023110: 98%, ENSRNOG00000012046: 98%
Entrez Gene ID: 10419
Uniprot ID: O14744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRMT5
Alternative Gene Name: HRMT1L5, SKB1, SKB1Hs
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023110: 98%, ENSRNOG00000012046: 98%
Entrez Gene ID: 10419
Uniprot ID: O14744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA |
Documents & Links for Anti PRMT5 pAb (ATL-HPA064708) | |
Datasheet | Anti PRMT5 pAb (ATL-HPA064708) Datasheet (External Link) |
Vendor Page | Anti PRMT5 pAb (ATL-HPA064708) at Atlas |
Documents & Links for Anti PRMT5 pAb (ATL-HPA064708) | |
Datasheet | Anti PRMT5 pAb (ATL-HPA064708) Datasheet (External Link) |
Vendor Page | Anti PRMT5 pAb (ATL-HPA064708) |