Anti PRKCH pAb (ATL-HPA053709)

Atlas Antibodies

SKU: ATL-HPA053709-25

• 
• 

Protein Description: protein kinase C, eta
Gene Name: PRKCH
Alternative Gene Name: PKC-L, PKCL, PRKCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021108: 97%, ENSRNOG00000004873: 97%
Entrez Gene ID: 5583
Uniprot ID: P24723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQ
• Gene Sequence: DHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQ
• Gene ID - Mouse: ENSMUSG00000021108
• Gene ID - Rat: ENSRNOG00000004873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.