Anti PRKCG pAb (ATL-HPA047870)

Atlas Antibodies

Catalog No.: ATL-HPA047870-25

Protein Description: protein kinase C, gamma
Gene Name: PRKCG
Alternative Gene Name: MGC57564, PKCC, PKCG, SCA14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097449: 100%, ENSRNOG00000054371: 100%
Entrez Gene ID: 5582
Uniprot ID: P05129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
• Gene Sequence: GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
• Gene ID - Mouse: ENSMUSG00000097449
• Gene ID - Rat: ENSRNOG00000054371
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.