Anti PRIMA1 pAb (ATL-HPA060047)
Atlas Antibodies
- SKU:
- ATL-HPA060047-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRIMA1
Alternative Gene Name: PRIMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041669: 91%, ENSRNOG00000008915: 89%
Entrez Gene ID: 145270
Uniprot ID: Q86XR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV |
| Gene Sequence | KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV |
| Gene ID - Mouse | ENSMUSG00000041669 |
| Gene ID - Rat | ENSRNOG00000008915 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRIMA1 pAb (ATL-HPA060047) | |
| Datasheet | Anti PRIMA1 pAb (ATL-HPA060047) Datasheet (External Link) |
| Vendor Page | Anti PRIMA1 pAb (ATL-HPA060047) at Atlas Antibodies |
| Documents & Links for Anti PRIMA1 pAb (ATL-HPA060047) | |
| Datasheet | Anti PRIMA1 pAb (ATL-HPA060047) Datasheet (External Link) |
| Vendor Page | Anti PRIMA1 pAb (ATL-HPA060047) |
| Citations for Anti PRIMA1 pAb (ATL-HPA060047) – 1 Found |
| Barták, Barbara Kinga; Kalmár, Alexandra; Péterfia, Bálint; Patai, Árpád V; Galamb, Orsolya; Valcz, Gábor; Spisák, Sándor; Wichmann, Barnabás; Nagy, Zsófia Brigitta; Tóth, Kinga; Tulassay, Zsolt; Igaz, Péter; Molnár, Béla. Colorectal adenoma and cancer detection based on altered methylation pattern of SFRP1, SFRP2, SDC2, and PRIMA1 in plasma samples. Epigenetics. 2017;12(9):751-763. PubMed |