Anti PRICKLE4 pAb (ATL-HPA055593)
Atlas Antibodies
- SKU:
- ATL-HPA055593-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRICKLE4
Alternative Gene Name: C6orf49, DKFZp761H221, OEBT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096549: 80%, ENSRNOG00000014180: 83%
Entrez Gene ID: 29964
Uniprot ID: Q2TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCG |
Gene Sequence | AELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCG |
Gene ID - Mouse | ENSMUSG00000096549 |
Gene ID - Rat | ENSRNOG00000014180 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRICKLE4 pAb (ATL-HPA055593) | |
Datasheet | Anti PRICKLE4 pAb (ATL-HPA055593) Datasheet (External Link) |
Vendor Page | Anti PRICKLE4 pAb (ATL-HPA055593) at Atlas Antibodies |
Documents & Links for Anti PRICKLE4 pAb (ATL-HPA055593) | |
Datasheet | Anti PRICKLE4 pAb (ATL-HPA055593) Datasheet (External Link) |
Vendor Page | Anti PRICKLE4 pAb (ATL-HPA055593) |