Anti PRICKLE4 pAb (ATL-HPA055593)

Atlas Antibodies

SKU:
ATL-HPA055593-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: prickle planar cell polarity protein 4
Gene Name: PRICKLE4
Alternative Gene Name: C6orf49, DKFZp761H221, OEBT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096549: 80%, ENSRNOG00000014180: 83%
Entrez Gene ID: 29964
Uniprot ID: Q2TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCG
Gene Sequence AELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCG
Gene ID - Mouse ENSMUSG00000096549
Gene ID - Rat ENSRNOG00000014180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRICKLE4 pAb (ATL-HPA055593)
Datasheet Anti PRICKLE4 pAb (ATL-HPA055593) Datasheet (External Link)
Vendor Page Anti PRICKLE4 pAb (ATL-HPA055593) at Atlas Antibodies

Documents & Links for Anti PRICKLE4 pAb (ATL-HPA055593)
Datasheet Anti PRICKLE4 pAb (ATL-HPA055593) Datasheet (External Link)
Vendor Page Anti PRICKLE4 pAb (ATL-HPA055593)