Protein Description: phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2
Gene Name: PREX2
Alternative Gene Name: DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048960: 98%, ENSRNOG00000005391: 98%
Entrez Gene ID: 80243
Uniprot ID: Q70Z35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PREX2
Alternative Gene Name: DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048960: 98%, ENSRNOG00000005391: 98%
Entrez Gene ID: 80243
Uniprot ID: Q70Z35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP |
Documents & Links for Anti PREX2 pAb (ATL-HPA075956) | |
Datasheet | Anti PREX2 pAb (ATL-HPA075956) Datasheet (External Link) |
Vendor Page | Anti PREX2 pAb (ATL-HPA075956) at Atlas |
Documents & Links for Anti PREX2 pAb (ATL-HPA075956) | |
Datasheet | Anti PREX2 pAb (ATL-HPA075956) Datasheet (External Link) |
Vendor Page | Anti PREX2 pAb (ATL-HPA075956) |