Anti PREX2 pAb (ATL-HPA075956)

Atlas Antibodies

SKU:
ATL-HPA075956-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2
Gene Name: PREX2
Alternative Gene Name: DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048960: 98%, ENSRNOG00000005391: 98%
Entrez Gene ID: 80243
Uniprot ID: Q70Z35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP
Gene Sequence HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP
Gene ID - Mouse ENSMUSG00000048960
Gene ID - Rat ENSRNOG00000005391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PREX2 pAb (ATL-HPA075956)
Datasheet Anti PREX2 pAb (ATL-HPA075956) Datasheet (External Link)
Vendor Page Anti PREX2 pAb (ATL-HPA075956) at Atlas Antibodies

Documents & Links for Anti PREX2 pAb (ATL-HPA075956)
Datasheet Anti PREX2 pAb (ATL-HPA075956) Datasheet (External Link)
Vendor Page Anti PREX2 pAb (ATL-HPA075956)