Protein Description: prolyl endopeptidase-like
Gene Name: PREPL
Alternative Gene Name: KIAA0436
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024127: 88%, ENSRNOG00000007326: 86%
Entrez Gene ID: 9581
Uniprot ID: Q4J6C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PREPL
Alternative Gene Name: KIAA0436
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024127: 88%, ENSRNOG00000007326: 86%
Entrez Gene ID: 9581
Uniprot ID: Q4J6C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYE |
Documents & Links for Anti PREPL pAb (ATL-HPA063238) | |
Datasheet | Anti PREPL pAb (ATL-HPA063238) Datasheet (External Link) |
Vendor Page | Anti PREPL pAb (ATL-HPA063238) at Atlas |
Documents & Links for Anti PREPL pAb (ATL-HPA063238) | |
Datasheet | Anti PREPL pAb (ATL-HPA063238) Datasheet (External Link) |
Vendor Page | Anti PREPL pAb (ATL-HPA063238) |