Protein Description: PR domain containing 4
Gene Name: PRDM4
Alternative Gene Name: PFM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035529: 93%, ENSRNOG00000004962: 95%
Entrez Gene ID: 11108
Uniprot ID: Q9UKN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRDM4
Alternative Gene Name: PFM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035529: 93%, ENSRNOG00000004962: 95%
Entrez Gene ID: 11108
Uniprot ID: Q9UKN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMC |
| Documents & Links for Anti PRDM4 pAb (ATL-HPA067437) | |
| Datasheet | Anti PRDM4 pAb (ATL-HPA067437) Datasheet (External Link) |
| Vendor Page | Anti PRDM4 pAb (ATL-HPA067437) at Atlas |
| Documents & Links for Anti PRDM4 pAb (ATL-HPA067437) | |
| Datasheet | Anti PRDM4 pAb (ATL-HPA067437) Datasheet (External Link) |
| Vendor Page | Anti PRDM4 pAb (ATL-HPA067437) |