Anti PRDM16 pAb (ATL-HPA060467)

Atlas Antibodies

SKU: ATL-HPA060467-25

• 

Protein Description: PR domain containing 16
Gene Name: PRDM16
Alternative Gene Name: KIAA1675, MEL1, MGC166915, PFM13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039410: 84%, ENSRNOG00000045913: 84%
Entrez Gene ID: 63976
Uniprot ID: Q9HAZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYS
• Gene Sequence: YKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYS
• Gene ID - Mouse: ENSMUSG00000039410
• Gene ID - Rat: ENSRNOG00000045913
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.