Anti PRC1 pAb (ATL-HPA048816 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048816-25

• 
• 

Protein Description: protein regulator of cytokinesis 1
Gene Name: PRC1
Alternative Gene Name: ASE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038943: 86%, ENSRNOG00000013057: 83%
Entrez Gene ID: 9055
Uniprot ID: O43663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMP
• Gene Sequence: DMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMP
• Gene ID - Mouse: ENSMUSG00000038943
• Gene ID - Rat: ENSRNOG00000013057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.