Anti PRAP1 pAb (ATL-HPA052451)
Atlas Antibodies
- SKU:
- ATL-HPA052451-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRAP1
Alternative Gene Name: UPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025467: 44%, ENSRNOG00000018446: 54%
Entrez Gene ID: 118471
Uniprot ID: Q96NZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR |
Gene Sequence | AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR |
Gene ID - Mouse | ENSMUSG00000025467 |
Gene ID - Rat | ENSRNOG00000018446 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRAP1 pAb (ATL-HPA052451) | |
Datasheet | Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link) |
Vendor Page | Anti PRAP1 pAb (ATL-HPA052451) at Atlas Antibodies |
Documents & Links for Anti PRAP1 pAb (ATL-HPA052451) | |
Datasheet | Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link) |
Vendor Page | Anti PRAP1 pAb (ATL-HPA052451) |