Anti PRADC1 pAb (ATL-HPA051066)

Atlas Antibodies

SKU: ATL-HPA051066-25

• 

Protein Description: protease-associated domain containing 1
Gene Name: PRADC1
Alternative Gene Name: C2orf7, hPAP21, MGC13004, PAP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030008: 100%, ENSRNOG00000050483: 100%
Entrez Gene ID: 84279
Uniprot ID: Q9BSG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQ
• Gene Sequence: DYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQ
• Gene ID - Mouse: ENSMUSG00000030008
• Gene ID - Rat: ENSRNOG00000050483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.