Anti PPP6C pAb (ATL-HPA050940)

Atlas Antibodies

SKU: ATL-HPA050940-25

• 
• 

Protein Description: protein phosphatase 6, catalytic subunit
Gene Name: PPP6C
Alternative Gene Name: PP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026753: 100%, ENSRNOG00000015145: 100%
Entrez Gene ID: 5537
Uniprot ID: O00743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
• Gene Sequence: CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
• Gene ID - Mouse: ENSMUSG00000026753
• Gene ID - Rat: ENSRNOG00000015145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP6C pAb (ATL-HPA050940) – 1 Found

Nacke, Marisa; Sandilands, Emma; Nikolatou, Konstantina; Román-Fernández, Álvaro; Mason, Susan; Patel, Rachana; Lilla, Sergio; Yelland, Tamas; Galbraith, Laura C A; Freckmann, Eva C; McGarry, Lynn; Morton, Jennifer P; Shanks, Emma; Leung, Hing Y; Markert, Elke; Ismail, Shehab; Zanivan, Sara; Blyth, Karen; Bryant, David M. An ARF GTPase module promoting invasion and metastasis through regulating phosphoinositide metabolism. Nature Communications. 2021;12(1):1623.