Anti PPP5C pAb (ATL-HPA056933)

Atlas Antibodies

SKU: ATL-HPA056933-25

• 
• 

Protein Description: protein phosphatase 5, catalytic subunit
Gene Name: PPP5C
Alternative Gene Name: PP5, PPP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003099: 100%, ENSRNOG00000016907: 100%
Entrez Gene ID: 5536
Uniprot ID: P53041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
• Gene Sequence: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
• Gene ID - Mouse: ENSMUSG00000003099
• Gene ID - Rat: ENSRNOG00000016907
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.