Anti PPP4R3A pAb (ATL-HPA063917)

Atlas Antibodies

SKU: ATL-HPA063917-25

• 
• 

Protein Description: protein phosphatase 4, regulatory subunit 3A
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 100%, ENSRNOG00000027773: 100%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME
• Gene Sequence: KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME
• Gene ID - Mouse: ENSMUSG00000041846
• Gene ID - Rat: ENSRNOG00000027773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.