Protein Description: protein phosphatase 4, regulatory subunit 3A
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 100%, ENSRNOG00000027773: 100%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 100%, ENSRNOG00000027773: 100%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME |
| Documents & Links for Anti PPP4R3A pAb (ATL-HPA063917) | |
| Datasheet | Anti PPP4R3A pAb (ATL-HPA063917) Datasheet (External Link) |
| Vendor Page | Anti PPP4R3A pAb (ATL-HPA063917) at Atlas |
| Documents & Links for Anti PPP4R3A pAb (ATL-HPA063917) | |
| Datasheet | Anti PPP4R3A pAb (ATL-HPA063917) Datasheet (External Link) |
| Vendor Page | Anti PPP4R3A pAb (ATL-HPA063917) |