Anti PPP2R3C pAb (ATL-HPA058834)

Atlas Antibodies

SKU: ATL-HPA058834-25

• 

Protein Description: protein phosphatase 2, regulatory subunit B'', gamma
Gene Name: PPP2R3C
Alternative Gene Name: C14orf10, FLJ20644, G4-1, G5PR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021022: 96%, ENSRNOG00000023591: 95%
Entrez Gene ID: 55012
Uniprot ID: Q969Q6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF
• Gene Sequence: LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF
• Gene ID - Mouse: ENSMUSG00000021022
• Gene ID - Rat: ENSRNOG00000023591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.