Protein Description: protein phosphatase 1 regulatory subunit 9A
Gene Name: PPP1R9A
Alternative Gene Name: FLJ20068, KIAA1222, Neurabin-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032827: 94%, ENSRNOG00000008869: 94%
Entrez Gene ID: 55607
Uniprot ID: Q9ULJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R9A
Alternative Gene Name: FLJ20068, KIAA1222, Neurabin-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032827: 94%, ENSRNOG00000008869: 94%
Entrez Gene ID: 55607
Uniprot ID: Q9ULJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS |
Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591) | |
Datasheet | Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link) |
Vendor Page | Anti PPP1R9A pAb (ATL-HPA075591) at Atlas |
Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591) | |
Datasheet | Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link) |
Vendor Page | Anti PPP1R9A pAb (ATL-HPA075591) |