Anti PPP1R27 pAb (ATL-HPA048632)

Atlas Antibodies

SKU: ATL-HPA048632-25

• 

Protein Description: protein phosphatase 1, regulatory subunit 27
Gene Name: PPP1R27
Alternative Gene Name: DYSFIP1, toonin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025129: 90%, ENSRNOG00000036690: 93%
Entrez Gene ID: 116729
Uniprot ID: Q86WC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
• Gene Sequence: YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
• Gene ID - Mouse: ENSMUSG00000025129
• Gene ID - Rat: ENSRNOG00000036690
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.