Anti PPP1R1B pAb (ATL-HPA048630)

Atlas Antibodies

SKU: ATL-HPA048630-100

• 
• 

Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 1B
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061718: 87%, ENSRNOG00000028404: 91%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
• Gene Sequence: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
• Gene ID - Mouse: ENSMUSG00000061718
• Gene ID - Rat: ENSRNOG00000028404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.