Anti PPP1R17 pAb (ATL-HPA047819)

Atlas Antibodies

SKU: ATL-HPA047819-25

• 
• 
• 

Protein Description: protein phosphatase 1, regulatory subunit 17
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 90%, ENSRNOG00000012235: 93%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH
• Gene Sequence: DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH
• Gene ID - Mouse: ENSMUSG00000002930
• Gene ID - Rat: ENSRNOG00000012235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP1R17 pAb (ATL-HPA047819) – 7 Found

Shekhar, Karthik; Lapan, Sylvain W; Whitney, Irene E; Tran, Nicholas M; Macosko, Evan Z; Kowalczyk, Monika; Adiconis, Xian; Levin, Joshua Z; Nemesh, James; Goldman, Melissa; McCarroll, Steven A; Cepko, Constance L; Regev, Aviv; Sanes, Joshua R. Comprehensive Classification of Retinal Bipolar Neurons by Single-Cell Transcriptomics. Cell. 2016;166(5):1308-1323.e30. 

Grimes, William N; Aytürk, Didem Göz; Hoon, Mrinalini; Yoshimatsu, Takeshi; Gamlin, Clare; Carrera, Daniel; Nath, Amurta; Nadal-Nicolás, Francisco M; Ahlquist, Richard M; Sabnis, Adit; Berson, David M; Diamond, Jeffrey S; Wong, Rachel O; Cepko, Connie; Rieke, Fred. A High-Density Narrow-Field Inhibitory Retinal Interneuron with Direct Coupling to Müller Glia. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(28):6018-6037. 

Pebworth, Mark-Phillip; Ross, Jayden; Andrews, Madeline; Bhaduri, Aparna; Kriegstein, Arnold R. Human intermediate progenitor diversity during cortical development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(26) 

Cui, Ling-Jie; Chen, Wen-Hao; Liu, Ai-Lin; Han, Xu; Jiang, Shi-Xiang; Yuan, Fei; Zhong, Yong-Mei; Yang, Xiong-Li; Weng, Shi-Jun. nGnG Amacrine Cells and Brn3b-negative M1 ipRGCs are Specifically Labeled in the ChAT-ChR2-EYFP Mouse. Investigative Ophthalmology & Visual Science. 2020;61(2):14. 

Yan, Wenjun; Laboulaye, Mallory A; Tran, Nicholas M; Whitney, Irene E; Benhar, Inbal; Sanes, Joshua R. Mouse Retinal Cell Atlas: Molecular Identification of over Sixty Amacrine Cell Types. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(27):5177-5195. 

Hu, Songhui; Wang, Yurong; Han, Xu; Dai, Min; Zhang, Yongxing; Ma, Yuanyuan; Weng, Shijun; Xiao, Lei. Activation of oxytocin receptors in mouse GABAergic amacrine cells modulates retinal dopaminergic signaling. Bmc Biology. 2022;20(1):205. 

Revah, Omer; Gore, Felicity; Kelley, Kevin W; Andersen, Jimena; Sakai, Noriaki; Chen, Xiaoyu; Li, Min-Yin; Birey, Fikri; Yang, Xiao; Saw, Nay L; Baker, Samuel W; Amin, Neal D; Kulkarni, Shravanti; Mudipalli, Rachana; Cui, Bianxiao; Nishino, Seiji; Grant, Gerald A; Knowles, Juliet K; Shamloo, Mehrdad; Huguenard, John R; Deisseroth, Karl; Pașca, Sergiu P. Maturation and circuit integration of transplanted human cortical organoids. Nature. 2022;610(7931):319-326.