Protein Description: protein phosphatase 1 regulatory subunit 16B
Gene Name: PPP1R16B
Alternative Gene Name: ANKRD4, KIAA0823, TIMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037754: 97%, ENSRNOG00000015614: 96%
Entrez Gene ID: 26051
Uniprot ID: Q96T49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R16B
Alternative Gene Name: ANKRD4, KIAA0823, TIMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037754: 97%, ENSRNOG00000015614: 96%
Entrez Gene ID: 26051
Uniprot ID: Q96T49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI |
| Documents & Links for Anti PPP1R16B pAb (ATL-HPA079512) | |
| Datasheet | Anti PPP1R16B pAb (ATL-HPA079512) Datasheet (External Link) |
| Vendor Page | Anti PPP1R16B pAb (ATL-HPA079512) at Atlas |
| Documents & Links for Anti PPP1R16B pAb (ATL-HPA079512) | |
| Datasheet | Anti PPP1R16B pAb (ATL-HPA079512) Datasheet (External Link) |
| Vendor Page | Anti PPP1R16B pAb (ATL-HPA079512) |