Anti PPP1R13L pAb (ATL-HPA059883)

Atlas Antibodies

SKU: ATL-HPA059883-25

• 

Protein Description: protein phosphatase 1, regulatory subunit 13 like
Gene Name: PPP1R13L
Alternative Gene Name: IASPP, RAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040734: 92%, ENSRNOG00000025350: 92%
Entrez Gene ID: 10848
Uniprot ID: Q8WUF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL
• Gene Sequence: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL
• Gene ID - Mouse: ENSMUSG00000040734
• Gene ID - Rat: ENSRNOG00000025350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.