Anti PPM1J pAb (ATL-HPA046045)

Atlas Antibodies

SKU: ATL-HPA046045-25

• 
• 

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1J
Gene Name: PPM1J
Alternative Gene Name: DKFZp434P1514, FLJ35951, MGC19531, PP2Czeta, PPP2CZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002228: 94%, ENSRNOG00000012481: 94%
Entrez Gene ID: 333926
Uniprot ID: Q5JR12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
• Gene Sequence: PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
• Gene ID - Mouse: ENSMUSG00000002228
• Gene ID - Rat: ENSRNOG00000012481
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.