Anti PPL pAb (ATL-HPA059859 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059859-25

• 
• 

Product Description

Protein Description: periplakin
Gene Name: PPL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039457: 94%, ENSRNOG00000002930: 94%
Entrez Gene ID: 5493
Uniprot ID: O60437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
• Gene Sequence: AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
• Gene ID - Mouse: ENSMUSG00000039457
• Gene ID - Rat: ENSRNOG00000002930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links