Anti PPIL6 pAb (ATL-HPA058165)

Atlas Antibodies

SKU:
ATL-HPA058165-25
  • Immunohistochemical staining of human fallopian tube shows strong membraneous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase like 6
Gene Name: PPIL6
Alternative Gene Name: bA425D10.6, dJ919F19.1, MGC41939, RSPH12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078451: 85%, ENSRNOG00000043186: 86%
Entrez Gene ID: 285755
Uniprot ID: Q8IXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPI
Gene Sequence SVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPI
Gene ID - Mouse ENSMUSG00000078451
Gene ID - Rat ENSRNOG00000043186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PPIL6 pAb (ATL-HPA058165)
Datasheet Anti PPIL6 pAb (ATL-HPA058165) Datasheet (External Link)
Vendor Page Anti PPIL6 pAb (ATL-HPA058165) at Atlas Antibodies

Documents & Links for Anti PPIL6 pAb (ATL-HPA058165)
Datasheet Anti PPIL6 pAb (ATL-HPA058165) Datasheet (External Link)
Vendor Page Anti PPIL6 pAb (ATL-HPA058165)