Anti PPIG pAb (ATL-HPA057469)

Atlas Antibodies

SKU: ATL-HPA057469-25

• 

Protein Description: peptidylprolyl isomerase G (cyclophilin G)
Gene Name: PPIG
Alternative Gene Name: CARS-Cyp, SCAF10, SRCyp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042133: 90%, ENSRNOG00000007673: 91%
Entrez Gene ID: 9360
Uniprot ID: Q13427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
• Gene Sequence: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
• Gene ID - Mouse: ENSMUSG00000042133
• Gene ID - Rat: ENSRNOG00000007673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.