Anti PPFIA4 pAb (ATL-HPA054132 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054132-25
  • Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-PPFIA4 antibody. Corresponding PPFIA4 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Gene Name: PPFIA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026458: 81%, ENSRNOG00000003494: 77%
Entrez Gene ID: 8497
Uniprot ID: O75335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS
Gene Sequence PFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS
Gene ID - Mouse ENSMUSG00000026458
Gene ID - Rat ENSRNOG00000003494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PPFIA4 pAb (ATL-HPA054132 w/enhanced validation)
Datasheet Anti PPFIA4 pAb (ATL-HPA054132 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPFIA4 pAb (ATL-HPA054132 w/enhanced validation)