Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053419-25

• 

Protein Description: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Gene Name: PPFIA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026458: 93%, ENSRNOG00000003494: 91%
Entrez Gene ID: 8497
Uniprot ID: O75335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
• Gene Sequence: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
• Gene ID - Mouse: ENSMUSG00000026458
• Gene ID - Rat: ENSRNOG00000003494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation) – 1 Found

Zhao, Ru; Feng, Tingting; Gao, Lin; Sun, Feifei; Zhou, Qianqian; Wang, Xin; Liu, Junmei; Zhang, Wenbo; Wang, Meng; Xiong, Xueting; Jia, Wenqiao; Chen, Weiwen; Wang, Lin; Han, Bo. PPFIA4 promotes castration-resistant prostate cancer by enhancing mitochondrial metabolism through MTHFD2. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):125.