Anti PPFIA3 pAb (ATL-HPA050340 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050340-25

• 

Protein Description: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Gene Name: PPFIA3
Alternative Gene Name: KIAA0654, LPNA3, MGC126567, MGC126569
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003863: 93%, ENSRNOG00000020731: 91%
Entrez Gene ID: 8541
Uniprot ID: O75145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDELLLNKEQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGAHLDPYVAGSGRAGKRGRWSGVKEEPSKDWERSA
• Gene Sequence: QDELLLNKEQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGAHLDPYVAGSGRAGKRGRWSGVKEEPSKDWERSA
• Gene ID - Mouse: ENSMUSG00000003863
• Gene ID - Rat: ENSRNOG00000020731
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.