Anti PPARGC1B pAb (ATL-HPA050543)

Atlas Antibodies

Catalog No.: ATL-HPA050543-25

Protein Description: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Gene Name: PPARGC1B
Alternative Gene Name: PERC, PGC1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 80%, ENSRNOG00000017503: 80%
Entrez Gene ID: 133522
Uniprot ID: Q86YN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLR
• Gene Sequence: IKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLR
• Gene ID - Mouse: ENSMUSG00000033871
• Gene ID - Rat: ENSRNOG00000017503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.