Anti PPARA pAb (ATL-HPA067049)

Atlas Antibodies

SKU: ATL-HPA067049-25

• 
• 

Protein Description: peroxisome proliferator-activated receptor alpha
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 87%, ENSRNOG00000021463: 89%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE
• Gene Sequence: HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE
• Gene ID - Mouse: ENSMUSG00000022383
• Gene ID - Rat: ENSRNOG00000021463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.