Protein Description: POU class 3 homeobox 1
Gene Name: POU3F1
Alternative Gene Name: OCT6, OTF6, SCIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090125: 100%, ENSRNOG00000004918: 33%
Entrez Gene ID: 5453
Uniprot ID: Q03052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU3F1
Alternative Gene Name: OCT6, OTF6, SCIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090125: 100%, ENSRNOG00000004918: 33%
Entrez Gene ID: 5453
Uniprot ID: Q03052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAG |
| Documents & Links for Anti POU3F1 pAb (ATL-HPA073824) | |
| Datasheet | Anti POU3F1 pAb (ATL-HPA073824) Datasheet (External Link) |
| Vendor Page | Anti POU3F1 pAb (ATL-HPA073824) at Atlas |
| Documents & Links for Anti POU3F1 pAb (ATL-HPA073824) | |
| Datasheet | Anti POU3F1 pAb (ATL-HPA073824) Datasheet (External Link) |
| Vendor Page | Anti POU3F1 pAb (ATL-HPA073824) |