Anti POU3F1 pAb (ATL-HPA073824)

Atlas Antibodies

SKU: ATL-HPA073824-25

• 

Protein Description: POU class 3 homeobox 1
Gene Name: POU3F1
Alternative Gene Name: OCT6, OTF6, SCIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090125: 100%, ENSRNOG00000004918: 33%
Entrez Gene ID: 5453
Uniprot ID: Q03052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAG
• Gene Sequence: AERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAG
• Gene ID - Mouse: ENSMUSG00000090125
• Gene ID - Rat: ENSRNOG00000004918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.