Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA050624-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: POU1F1
Alternative Gene Name: GHF-1, PIT1, POU1F1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004842: 94%, ENSRNOG00000000715: 95%
Entrez Gene ID: 5449
Uniprot ID: P28069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS |
| Gene Sequence | FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS |
| Gene ID - Mouse | ENSMUSG00000004842 |
| Gene ID - Rat | ENSRNOG00000000715 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) | |
| Datasheet | Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) | |
| Datasheet | Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) |
| Citations for Anti POU1F1 pAb (ATL-HPA050624 w/enhanced validation) – 1 Found |
| Sakata, Kiyohiko; Fujimori, Kana; Komaki, Satoru; Furuta, Takuya; Sugita, Yasuo; Ashida, Kenji; Nomura, Masatoshi; Morioka, Motohiro. Pituitary Gangliocytoma Producing TSH and TRH: A Review of "Gangliocytomas of the Sellar Region". The Journal Of Clinical Endocrinology And Metabolism. 2020;105(10):3109-21. PubMed |