Anti POLR3H pAb (ATL-HPA046787 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046787-25

• 
• 
• 

Protein Description: polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
Gene Name: POLR3H
Alternative Gene Name: KIAA1665, RPC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022476: 97%, ENSRNOG00000004471: 97%
Entrez Gene ID: 171568
Uniprot ID: Q9Y535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
• Gene Sequence: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
• Gene ID - Mouse: ENSMUSG00000022476
• Gene ID - Rat: ENSRNOG00000004471
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.