Anti POLR2G pAb (ATL-HPA053000)

Atlas Antibodies

SKU:
ATL-HPA053000-25
  • Immunohistochemical staining of human thyroid gland shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide G
Gene Name: POLR2G
Alternative Gene Name: hRPB19, hsRPB7, RPB7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071662: 100%, ENSRNOG00000019439: 100%
Entrez Gene ID: 5436
Uniprot ID: P62487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMD
Gene Sequence NLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMD
Gene ID - Mouse ENSMUSG00000071662
Gene ID - Rat ENSRNOG00000019439
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLR2G pAb (ATL-HPA053000)
Datasheet Anti POLR2G pAb (ATL-HPA053000) Datasheet (External Link)
Vendor Page Anti POLR2G pAb (ATL-HPA053000) at Atlas Antibodies

Documents & Links for Anti POLR2G pAb (ATL-HPA053000)
Datasheet Anti POLR2G pAb (ATL-HPA053000) Datasheet (External Link)
Vendor Page Anti POLR2G pAb (ATL-HPA053000)