Anti POLR1E pAb (ATL-HPA052400)

Atlas Antibodies

SKU: ATL-HPA052400-25

• 

Protein Description: polymerase (RNA) I polypeptide E, 53kDa
Gene Name: POLR1E
Alternative Gene Name: FLJ13390, FLJ13970, PAF53, PRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028318: 77%, ENSRNOG00000012664: 73%
Entrez Gene ID: 64425
Uniprot ID: Q9GZS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
• Gene Sequence: LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
• Gene ID - Mouse: ENSMUSG00000028318
• Gene ID - Rat: ENSRNOG00000012664
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.