Anti POLR1A pAb (ATL-HPA049700)

Atlas Antibodies

SKU:
ATL-HPA049700-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) I polypeptide A, 194kDa
Gene Name: POLR1A
Alternative Gene Name: DKFZP586M0122, FLJ21915, RPA1, RPO1-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049553: 93%, ENSRNOG00000009545: 95%
Entrez Gene ID:
Uniprot ID: O95602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR
Gene Sequence DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR
Gene ID - Mouse ENSMUSG00000049553
Gene ID - Rat ENSRNOG00000009545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLR1A pAb (ATL-HPA049700)
Datasheet Anti POLR1A pAb (ATL-HPA049700) Datasheet (External Link)
Vendor Page Anti POLR1A pAb (ATL-HPA049700) at Atlas Antibodies

Documents & Links for Anti POLR1A pAb (ATL-HPA049700)
Datasheet Anti POLR1A pAb (ATL-HPA049700) Datasheet (External Link)
Vendor Page Anti POLR1A pAb (ATL-HPA049700)