Anti POLG pAb (ATL-HPA078482)

Catalog No:
ATL-HPA078482-25
$395.00
Protein Description: DNA polymerase gamma, catalytic subunit
Gene Name: POLG
Alternative Gene Name: POLG1, POLGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039176: 83%, ENSRNOG00000032293: 81%
Entrez Gene ID: 5428
Uniprot ID: P54098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD
Gene ID - Mouse ENSMUSG00000039176
Gene ID - Rat ENSMUSG00000039176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti POLG pAb (ATL-HPA078482)
Datasheet Anti POLG pAb (ATL-HPA078482) Datasheet (External Link)
Vendor Page Anti POLG pAb (ATL-HPA078482) at Atlas

Documents & Links for Anti POLG pAb (ATL-HPA078482)
Datasheet Anti POLG pAb (ATL-HPA078482) Datasheet (External Link)
Vendor Page Anti POLG pAb (ATL-HPA078482)