Protein Description: DNA polymerase gamma, catalytic subunit
Gene Name: POLG
Alternative Gene Name: POLG1, POLGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039176: 83%, ENSRNOG00000032293: 81%
Entrez Gene ID: 5428
Uniprot ID: P54098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLG
Alternative Gene Name: POLG1, POLGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039176: 83%, ENSRNOG00000032293: 81%
Entrez Gene ID: 5428
Uniprot ID: P54098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD |
| Documents & Links for Anti POLG pAb (ATL-HPA078482) | |
| Datasheet | Anti POLG pAb (ATL-HPA078482) Datasheet (External Link) |
| Vendor Page | Anti POLG pAb (ATL-HPA078482) at Atlas |
| Documents & Links for Anti POLG pAb (ATL-HPA078482) | |
| Datasheet | Anti POLG pAb (ATL-HPA078482) Datasheet (External Link) |
| Vendor Page | Anti POLG pAb (ATL-HPA078482) |