Anti POLE3 pAb (ATL-HPA047945)

Atlas Antibodies

SKU:
ATL-HPA047945-25
  • Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), epsilon 3, accessory subunit
Gene Name: POLE3
Alternative Gene Name: CHARAC17, CHRAC17, p17, Ybl1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028394: 100%, ENSRNOG00000055277: 100%
Entrez Gene ID: 54107
Uniprot ID: Q9NRF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN
Gene Sequence MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN
Gene ID - Mouse ENSMUSG00000028394
Gene ID - Rat ENSRNOG00000055277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLE3 pAb (ATL-HPA047945)
Datasheet Anti POLE3 pAb (ATL-HPA047945) Datasheet (External Link)
Vendor Page Anti POLE3 pAb (ATL-HPA047945) at Atlas Antibodies

Documents & Links for Anti POLE3 pAb (ATL-HPA047945)
Datasheet Anti POLE3 pAb (ATL-HPA047945) Datasheet (External Link)
Vendor Page Anti POLE3 pAb (ATL-HPA047945)