Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046524-25
  • Immunohistochemistry analysis in human lymph node and liver tissues using HPA046524 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), delta 1, catalytic subunit
Gene Name: POLD1
Alternative Gene Name: CDC2, POLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038644: 88%, ENSRNOG00000019681: 89%
Entrez Gene ID: 5424
Uniprot ID: P28340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPD
Gene Sequence YALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPD
Gene ID - Mouse ENSMUSG00000038644
Gene ID - Rat ENSRNOG00000019681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation)
Datasheet Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation)
Datasheet Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation)



Citations for Anti POLD1 pAb (ATL-HPA046524 w/enhanced validation) – 1 Found
Godlewski, Janusz; Stefaniak, Przemyslaw; Kiezun, Jacek; Krazinski, Bartlomiej Emil. DNA Polymerase Delta 1 Catalytic Subunit (POLD1) as a Prognostic Factor in Clear Cell Renal Cell Carcinoma Patients. In Vivo (Athens, Greece). 2022;36(3):1188-1194.  PubMed