Protein Description: polymerase (DNA directed), beta
Gene Name: POLB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031536: 97%, ENSRNOG00000019150: 97%
Entrez Gene ID: 5423
Uniprot ID: P06746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031536: 97%, ENSRNOG00000019150: 97%
Entrez Gene ID: 5423
Uniprot ID: P06746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE |
Gene Sequence | YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE |
Gene ID - Mouse | ENSMUSG00000031536 |
Gene ID - Rat | ENSRNOG00000019150 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti POLB pAb (ATL-HPA049104 w/enhanced validation) | |
Datasheet | Anti POLB pAb (ATL-HPA049104 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POLB pAb (ATL-HPA049104 w/enhanced validation) at Atlas |
Documents & Links for Anti POLB pAb (ATL-HPA049104 w/enhanced validation) | |
Datasheet | Anti POLB pAb (ATL-HPA049104 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POLB pAb (ATL-HPA049104 w/enhanced validation) |