Anti POLB pAb (ATL-HPA049104 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049104-25

• 
• 
• 

Protein Description: polymerase (DNA directed), beta
Gene Name: POLB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031536: 97%, ENSRNOG00000019150: 97%
Entrez Gene ID: 5423
Uniprot ID: P06746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
• Gene Sequence: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
• Gene ID - Mouse: ENSMUSG00000031536
• Gene ID - Rat: ENSRNOG00000019150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.