Anti POC5 pAb (ATL-HPA061521)
Atlas Antibodies
- SKU:
- ATL-HPA061521-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: POC5 centriolar protein
Gene Name: POC5
Alternative Gene Name: C5orf37, FLJ35779, hPOC5, MGC120442, MGC120443, MGC120444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021671: 83%, ENSRNOG00000018193: 82%
Entrez Gene ID: 134359
Uniprot ID: Q8NA72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POC5
Alternative Gene Name: C5orf37, FLJ35779, hPOC5, MGC120442, MGC120443, MGC120444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021671: 83%, ENSRNOG00000018193: 82%
Entrez Gene ID: 134359
Uniprot ID: Q8NA72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVH |
Gene Sequence | YVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVH |
Gene ID - Mouse | ENSMUSG00000021671 |
Gene ID - Rat | ENSRNOG00000018193 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POC5 pAb (ATL-HPA061521) | |
Datasheet | Anti POC5 pAb (ATL-HPA061521) Datasheet (External Link) |
Vendor Page | Anti POC5 pAb (ATL-HPA061521) at Atlas Antibodies |
Documents & Links for Anti POC5 pAb (ATL-HPA061521) | |
Datasheet | Anti POC5 pAb (ATL-HPA061521) Datasheet (External Link) |
Vendor Page | Anti POC5 pAb (ATL-HPA061521) |