Anti PNPLA5 pAb (ATL-HPA054211)

Atlas Antibodies

SKU: ATL-HPA054211-25

• 

Protein Description: patatin-like phospholipase domain containing 5
Gene Name: PNPLA5
Alternative Gene Name: dJ388M5.4, GS2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018868: 63%, ENSRNOG00000022296: 70%
Entrez Gene ID: 150379
Uniprot ID: Q7Z6Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQGLLRNMALEVFSRTK
• Gene Sequence: LEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQGLLRNMALEVFSRTK
• Gene ID - Mouse: ENSMUSG00000018868
• Gene ID - Rat: ENSRNOG00000022296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.