Anti PNMAL2 pAb (ATL-HPA054810 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054810-25

• 

Protein Description: paraneoplastic Ma antigen family-like 2
Gene Name: PNMAL2
Alternative Gene Name: KIAA1183
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070802: 61%, ENSRNOG00000016863: 62%
Entrez Gene ID: 57469
Uniprot ID: Q9ULN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVTGIPEGLEQADVEAVLQPTLLPLGTFRLRHMKALMNEKAQAALVEFVEDVNHAAIPREI
• Gene Sequence: LVTGIPEGLEQADVEAVLQPTLLPLGTFRLRHMKALMNEKAQAALVEFVEDVNHAAIPREI
• Gene ID - Mouse: ENSMUSG00000070802
• Gene ID - Rat: ENSRNOG00000016863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.