Anti PNLIPRP3 pAb (ATL-HPA046202)
Atlas Antibodies
- SKU:
- ATL-HPA046202-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PNLIPRP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025091: 36%, ENSRNOG00000017982: 36%
Entrez Gene ID: 119548
Uniprot ID: Q17RR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVINTSGKYGYKSTFCSQDIMGPNILQNLKPC |
Gene Sequence | KLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVINTSGKYGYKSTFCSQDIMGPNILQNLKPC |
Gene ID - Mouse | ENSMUSG00000025091 |
Gene ID - Rat | ENSRNOG00000017982 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PNLIPRP3 pAb (ATL-HPA046202) | |
Datasheet | Anti PNLIPRP3 pAb (ATL-HPA046202) Datasheet (External Link) |
Vendor Page | Anti PNLIPRP3 pAb (ATL-HPA046202) at Atlas Antibodies |
Documents & Links for Anti PNLIPRP3 pAb (ATL-HPA046202) | |
Datasheet | Anti PNLIPRP3 pAb (ATL-HPA046202) Datasheet (External Link) |
Vendor Page | Anti PNLIPRP3 pAb (ATL-HPA046202) |